SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9KCQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9KCQ3
Domain Number 1 Region: 63-334
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.81e-76
Family L-arabinose binding protein-like 0.00000338
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.5e-17
Family GalR/LacI-like bacterial regulator 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9KCQ3
Sequence length 343
Comment (tr|Q9KCQ3|Q9KCQ3_BACHD) Glucose-resistance amylase regulator {ECO:0000313|EMBL:BAB05235.1} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH1516 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNRPTIKDVAREANVSIATVSRILNKGVGYSEKTKQHVLETIEKMGYHPNAVARGLINKK
TDSIGVLFPNVSGLISAQILQGIEEVAQSHGISVIVCNTASDHKKTMDYLTFLQEKQVDG
LLFISQLLTKDYREFIKKMGVPIITISAFSETNDVPYVKVDDEAASYDAVRYLIEKGHTD
IGMISGPPTDPLAGHPRIQGYKRALREADLPFIETKMTWHKGFYFEDGQVAFQKLLKSHP
SITALFAASDELAISAVSSAYHLGIRVPHQLSVIGYDDTKLAKMSIPPLTTVSQPFEEMG
AQATKKLIDSIQSREPNTSLTMPHRIAERESVKNRMAAPNGHV
Download sequence
Identical sequences Q9KCQ3
272558.BH1516 gi|15614079|ref|NP_242382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]