SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9KFL1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9KFL1
Domain Number 1 Region: 68-275
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.59e-46
Family Transferrin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9KFL1
Sequence length 323
Comment (tr|Q9KFL1|Q9KFL1_BACHD) Phosphonates transport system (Phosphate-binding protein) {ECO:0000313|EMBL:BAB04187.1} KW=Complete proteome; Reference proteome OX=272558 OS=9153 / C-125). GN=BH0468 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MKKWLQGLMVAAVAVGMTACGSSETTGEDKQAEGNTGEVDHAEVDRSNWPETFVYGILPT
EDQGELASRFEALEDYLEEKVGIEFELFVGTDYNALIEGMRNGHVHASGFGPFSYMLAHE
RANAEAFATGVSDPEDAFYYSWFITLEETNLNGLEDLDGATIAYADPASTSGHIFPKGML
ITELGLTMDNVDDYFSYVTFSGSHEASLYSVLNGDVDVAGVCSSCIENIYDRVEDHPNFE
QLKVIAESDPIPNGPQAISMDLPEDLRELIIDAFLTMHEDPSMQEFLESNGYDAGYIEVD
DSMYDVVRETAEALEMSAEDLLN
Download sequence
Identical sequences Q9KFL1
APC41268.0 gi|15613031|ref|NP_241334.1| 272558.BH0468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]