SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9LP07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9LP07
Domain Number 1 Region: 124-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.16e-23
Family B3 DNA binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9LP07
Sequence length 222
Comment (sp|Q9LP07|ARFW_ARATH) Putative auxin response factor 23 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=ARF23; OC=Arabidopsis.
Sequence
MESGNVVNVQSELSGIIDGSKSYMYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVEAS
TREELNELQPNCDLPSKLQCRVIAIHLKVENNSDETYVEITLMPDTTQVVIPTENENQFR
PIVNSFTKVLTASDTSAQGEFSVPCKHAIECLPPLDMSQPIPAQELIAIDLHGNQWRFKH
SYRVPRGDTTGWNAFTTSKKLVVGDVIVFARGETGELRVGIR
Download sequence
Identical sequences Q9LP07
AT1G43950.1 NP_175062.1.80155 3702.AT1G43950.1-P AT1G43950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]