SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9LUC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9LUC1
Domain Number 1 Region: 139-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.66e-16
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9LUC1
Sequence length 343
Comment (tr|Q9LUC1|Q9LUC1_ARATH) RING/FYVE/PHD zinc finger superfamily protein {ECO:0000313|EMBL:AEE75562.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g14740 OC=Arabidopsis.
Sequence
MDAQYQDLPPLKRLRLLQRDLEAAQQHQLPNQPEMKSLQLPAKKRKQTRVDYDDDDAENS
NPTYHCLPAKKRIWAIDPDLLSGGGNPFSPFDLNVEYKPYVEEKSIEKKSTLNVESSLEV
EEDDDKENIDPLGKGKALDLSDREVEDEDGIMCAVCQSTDGDPLNPIVFCDGCDLMVHAS
CYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTNDGRWAHITCALFVP
EVYFEDPEGREGICCSEVLSKRWKDRCYLCKVRRGCVIECSEMRCKLAFHVTCGLKEDLC
IEYREGKKSGGIVVGFCNEHTKLWERQQESGKYKIVAREEDKK
Download sequence
Identical sequences A0A178VIT7 Q9LUC1
AT3G14740.2 AT3G14740.2 NP_974313.1.80155 3702.AT3G14740.2-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]