SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9LXE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9LXE1
Domain Number 1 Region: 15-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-21
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 213-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000235
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9LXE1
Sequence length 308
Comment (sp|Q9LXE1|REM23_ARATH) Protein REPRODUCTIVE MERISTEM 23 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=REM23; OC=Arabidopsis.
Sequence
MASNPDFLWCKEERKQESFFKVLKRSDMSSEDTRAIPYDFVINFSDNELSGDMKFRVQWG
NSWKVKISKNPRFYFMEKSGWEKFVIDNALGDHEFLTFTHKGQMSFTVKIFNKDGKEMMQ
PPQSRASFASSSRVKTEQDVKREEEVLVSSDSRSRGPTTAAETNRGGSYKRKLNFGKKKA
EETQTYKRTERTQNSKRTERVVSKERVYAGEPSSSVAGFKIFISKSYIKSLAIPKPFGNY
MPKEKTRVKIHHPDGEKTWKVVFVVKERGQIFSGGWKRLCKEYPVVFGDTCKFTLITPLE
LLLVVSKP
Download sequence
Identical sequences A0A178UQ85 Q9LXE1
NP_196540.1.80155 3702.AT5G09780.1-P AR1788 AT5G09780.1 AT5G09780.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]