SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9LYL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9LYL4
Domain Number - Region: 120-161
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0676
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9LYL4
Sequence length 173
Comment (tr|Q9LYL4|Q9LYL4_ARATH) Potassium transporter {ECO:0000313|EMBL:AEE79505.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g56290 OC=Arabidopsis.
Sequence
MGFRALPLQHSSGFISTTKVSISRTSPRIFRNPRWVVVSAKQEKDEDKKKNEEETSLFTQ
LTDALDFSQVRSEKDAELLYEAREATKSGRKMTQEQYGALRRKIGGTYKDFFKSYVEVDG
QYVEEGWVDKTCKICKKDTKGEARQVDKLGRYAHVSCLQNPPSGNFFTRLFSR
Download sequence
Identical sequences A0A178V844 Q9LYL4
AT3G56290.1 3702.AT3G56290.1-P AT3G56290.1 NP_191188.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]