SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9M207 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9M207
Domain Number - Region: 5-59
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000594
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9M207
Sequence length 129
Comment (tr|Q9M207|Q9M207_ARATH) Zinc ion-binding protein {ECO:0000313|EMBL:AEE80074.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g60520 OC=Arabidopsis.
Sequence
MVDLERRVCCMCGDVGFFDKLFHCSKCLNRFQHSYCSSYYKEQADPIKICDWCQCEAKSR
TGAKHGVNGGSSKRSYRSEYSSPHHQIKQQEINQTTSSSIPPAADKGKTGVPSPRPATRR
YKLLKDVMC
Download sequence
Identical sequences A0A178V606 Q9M207
AT3G60520.1 NP_191611.1.80155 AT3G60520.1 3702.AT3G60520.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]