SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9RDL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9RDL7
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily DAK1/DegV-like 5.75e-77
Family DegV-like 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9RDL7
Sequence length 281
Comment (sp|Q9RDL7|Y2569_STRCO) DegV domain-containing protein SCO2569 KW=Complete proteome; Reference proteome OX=100226 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145). GN=SCO2569; OC=Streptomyces; Streptomyces albidoflavus group.
Sequence
MSRHVAIVTDSTAYLPARAMERHGITAVPLTVVLGDRALEEGTEISTRSLAQALQKRRPV
TTSRPNPELFAETYRRIAESGADGIVSLHLSAELSGTHDAAVVAAREAPVPVRVVDTGMI
AMALGFCALAAAETAEAGGTVDEAVTAAEKRAAGTSAYFYVDTLDYLRRGGRIGAAQALF
GSALAVKPLLQLEGGRIEPLEKVRTASKAIARLEEIAADRAGGAPVDIAVHHLAAPDRAS
ALADRLRDRVPGLADLHVSEVGAVIGAHTGPGLLGVVVSSR
Download sequence
Identical sequences D6ED33 Q9RDL7
100226.SCO2569 NP_626807.1.49638 WP_003976234.1.26049 WP_003976234.1.43399 WP_003976234.1.55229 WP_003976234.1.86682 gi|21221028|ref|NP_626807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]