SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9RJR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9RJR0
Domain Number 1 Region: 11-333
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.31e-100
Family DAK1 0.0000018
Further Details:      
 
Domain Number 2 Region: 385-588
Classification Level Classification E-value
Superfamily DhaL-like 4.32e-43
Family DhaL-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9RJR0
Sequence length 593
Comment (tr|Q9RJR0|Q9RJR0_STRCO) Putative glycerone kinase {ECO:0000313|EMBL:CAB61274.1} KW=Complete proteome; Reference proteome OX=100226 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145). GN=SCO0580 OC=Streptomyces; Streptomyces albidoflavus group.
Sequence
MTRLFNDPAAFADEALEGFTAAHRRWVRPVTGGVVRATATPAGQVAVVIGGGSGHYPAFS
GLVGRGLAHGAAVGNVFASPSARQIHSVATAAHGGGGVLLMYGNYAGDVLHFGQAAERLA
ADGIETRTFAVADDISSAGPDESAKRRGIAGDLPVFKAAAAAAEQGLPLEEVLRVAERAG
VRTRSFGIAFSGCTLPGADHPLFTVPEARMAVGLGIHGEPGIGEEALPTADEAALLLVET
LLKELPDDVADPAGRRAAVILNGLGSVKYEELFVVYRKVAALLGDAGVEIVDPEVGELVT
SFDMAGISLTLTWLDDRLEELWRAPADTPAYRKGALGDPEPDQDRAAATAGQDTAAAQDT
AVSDAAASGTTAVPVASDASRRAAGTVLAALDAVARVVDAHAGELGRIDAVAGDGDHGIG
MRRGSSAAHRAAHDAHRVGAGAGTVLTRAADDWADKAGGTSGALWGTILRSLGTALGDRD
APDAARVAEGVTEASAAVRRLGGAEVGDKTMVDVLVPFADALAAATAEGLPLAEAWDRAA
TTATAAAAGTADLLPRRGRARPHAEKSLGTPDAGAHSLALITRAVHGALLDHH
Download sequence
Identical sequences Q9RJR0
100226.SCO0580 NP_624892.1.49638 gi|21219113|ref|NP_624892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]