SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9SAD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9SAD4
Domain Number 1 Region: 56-114
Classification Level Classification E-value
Superfamily DNA-binding domain 5.1e-21
Family GCC-box binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9SAD4
Sequence length 328
Comment (sp|Q9SAD4|ESR1_ARATH) Protein ENHANCER OF SHOOT REGENERATION 1 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F3F19.1; OC=Arabidopsis.
Sequence
MEKALRNFTESTHSPDPNPLTKFFTEPTASPVSRNRKLSSKDTTVTIAGAGSSTTRYRGV
RRRPWGRYAAEIRDPMSKERRWLGTFDTAEQAACAYDSAARAFRGAKARTNFTYPTAVIM
PEPRFSFSNKKSSPSARCPLPSLPLDSSTQNFYGAPAAQRIYNTQSIFLRDASCSSRKTT
PYNNSFNGSSSSYSASKTACVSYSENENNESFFPEESSDTGLLQEVVQEFLKKNRGVPPS
PPTPPPVTSHHDNSGYFSNLTIYSENMVQETKETLSSKLDRYGNFQANDDGVRAVADGGL
SLGSNEWGYQEMLMYGTQLGCTCRRSWG
Download sequence
Identical sequences Q9SAD4
AT1G12980.1 NP_172758.1.80155 3702.AT1G12980.1-P AT1G12980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]