SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9SCJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9SCJ8
Domain Number 1 Region: 207-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9SCJ8
Sequence length 334
Comment (sp|Q9SCJ8|Y3961_ARATH) Putative B3 domain-containing protein At3g49610 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g49610; OC=Arabidopsis.
Sequence
MNRNHHDHLDAAGKDMWSRLSDLADKADMLYEREGISKDRKSVSEEEEEKKTRFSILVDL
VGRLCDQEERRTLGSSPTKTNTLFEGSEKSHLDHHLDHLPQKPRSSLECFFTRVYTRRNH
NNVSTSSSLFNTDEFERTETKSPTIRNSQSSPSSCLMENTKRKRYQSSGKSKKPKFDPFS
LTAARETPEWLLDVMRKMKGAEGPIKLIYEKTLTATDVKPSESRLLIPFNKLLRNDFLTP
EESRAIAIDKEEEEEDTKKIGVKTIIVNQFSKEWSLRFLIWVMKKKKSGNGTLYYTLNRG
WNGVVSGNKLKANDNISLWTFRCGGVLCFALEKE
Download sequence
Identical sequences Q9SCJ8
AT3G49610.1 AT3G49610.1 NP_190530.1.80155 3702.AT3G49610.1-P GO.14545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]