SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9SFW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9SFW0
Domain Number 1 Region: 4-95,176-404
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.91e-84
Family IF2B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9SFW0
Sequence length 407
Comment (tr|Q9SFW0|Q9SFW0_ARATH) Putative translation initiation factor EIF-2B beta subunit {ECO:0000313|EMBL:AAF20216.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g07300 OC=Arabidopsis.
Sequence
MPDVQSTVVEFVNKLRKRKIEGSQATAKYTVELLRSVISHQRVPHANQAAALIDAVKAVG
EQLIAANPVELAVGNVVRRVLHIIREEDLSLTTAAMGGLDLLDASDDDDVDNCKGIGFPA
MSAAVVAAAARSTLRPPSLQTLLEGTPESATVPYTSSSGADSESKTADKSSLTRKLKHDV
IEGVNQLIQEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFVA
EGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVN
MAALAAQKHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGAGSG
SLQVVNPTFDYVPPNLVSLFITDTGGHNPSYMYRLIADYYSADDLVM
Download sequence
Identical sequences A0A178V9K7 Q9SFW0
AT3G07300.1 AT3G07300.2 NP_001030655.1.80155 NP_187386.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]