SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9SJ07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9SJ07
Domain Number 1 Region: 167-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000147
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9SJ07
Sequence length 278
Comment (sp|Q9SJ07|Y2192_ARATH) Putative B3 domain-containing protein At2g21920 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At2g21920; OC=Arabidopsis.
Sequence
MSFDVRSEKIDLIKGPELPDYNMFMSQKFTSYEGKLAILLTGNGDCSFYMWILEDAAKHE
WSKKAYVVPDFFPLDPFVLLMQRANENDIVRTFHYDDRVGTSDAIVESTPASPPRHIMFS
VIIRKDSPLRNLRGAKSIFKVSFTIILKTFIVKLIMMKDFQLDGDMIISKTLSRTDVDHH
GRLFLPKNQVLSVLKKMRNVTKESLRKGIELEVVDIIENDSYSVILKSRNTTNDFVLASG
WSIMKHSLDLQEGDDIKLFWDYLNYKFIILNFEYNLIP
Download sequence
Identical sequences Q9SJ07
NP_179783.1.80155 AT2G21920.1 3702.AT2G21920.1-P AT2G21920.1 AR754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]