SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9SLI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9SLI4
Domain Number 1 Region: 96-162
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.36e-20
Family Rubredoxin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9SLI4
Sequence length 195
Comment (tr|Q9SLI4|Q9SLI4_ARATH) Rubredoxin-like superfamily protein {ECO:0000313|EMBL:AEE33110.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F20D21.31 OC=Arabidopsis.
Sequence
MASATFSFCPLSQSHPHSSLIKPTPFLRYGKKLHHLHHHIFITISYPSHHSRYLAVSRDD
AATPLSSSDQTQETETKEVEDTIEKRRMEEKFAVLNTGIYECRSCGYKYDESAGDPSYPI
PPGFQFDKLPEDWRCPTCGAAQSFFESKMVEIAGFAQNQQYGLGGNALTSGQKTGLIFGS
LLLFFALFLSGYFIQ
Download sequence
Identical sequences A0A178W6Q7 Q9SLI4
AT1G54500.1 3702.AT1G54500.1-P NP_175852.1.80155 AT1G54500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]