SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UEL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UEL4
Domain Number 1 Region: 15-124
Classification Level Classification E-value
Superfamily Immunoglobulin 6.76e-21
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UEL4
Sequence length 243
Comment (tr|Q9UEL4|Q9UEL4_HUMAN) Uncharacterized protein {ECO:0000313|EMBL:CAA22913.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
PFSSVTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVS
FFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQ
PGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTS
ESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADI
RKN
Download sequence
Identical sequences Q9UEL4
ENSGGOP00000002844 ENSGGOP00000002844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]