SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9UGJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UGJ0
Domain Number 1 Region: 258-416
Classification Level Classification E-value
Superfamily CBS-domain pair 2.02e-41
Family CBS-domain pair 0.000000158
Further Details:      
 
Domain Number 2 Region: 421-557
Classification Level Classification E-value
Superfamily CBS-domain pair 4.42e-31
Family CBS-domain pair 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9UGJ0
Sequence length 569
Comment (sp|Q9UGJ0|AAKG2_HUMAN) H91620p KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRKAG2; OC=Catarrhini; Hominidae; Homo.
Sequence
MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE
Download sequence
Identical sequences A0A090N8Q6 A0A2J8RKH9 K7DNG6 Q9UGJ0
9606.ENSP00000287878 ENSP00000287878 gi|33186925|ref|NP_057287.2| NP_057287.2.87134 NP_057287.2.92137 ENSPTRP00000047541 ENSP00000376549 ENSP00000287878 ENSPTRP00000047541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]