SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VA50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VA50
Domain Number 1 Region: 175-260
Classification Level Classification E-value
Superfamily TPR-like 0.00000359
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VA50
Sequence length 534
Comment (tr|Q9VA50|Q9VA50_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAF57073.4} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31013 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGYFIRCLLVMLFHSTLVLGHRPLEKSHSLSLVTMVPLLELEKKLIDNLENYTNALEQKL
EIIRSQLLVIRAENEKGRRNAISYLSNPLNGFSIIRRLHQDWINWRKYMEQPVGIWQLKA
FYSWKDELPTERDLWDACEGIARIQSTYDLKVGDFINGNINGKQYNDSMSTADILSVGAY
LFMKNRPSDAIQWLQEVPQRLQEELLIQPRHLPIKEVDALRLLAEAQIKDQNYSEALPLL
HNCLKLQPHDARVLRLWKKTTDFIENQPDQSPTENKKRNVPIANAFKLSCNGPLESSTRL
HCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKER
AVPKKNRGRTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHM
DYFDFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDVGYYVSPQAGTAIFW
YNLDTDGNGDPRTRHAACPVIVGSKWVMTEWIREKRQIFIRPCLPKAKGTSTKS
Download sequence
Identical sequences Q9VA50
FBpp0085033 FBpp0085033 FBpp0085033 NP_733394.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]