SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VA64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VA64
Domain Number - Region: 166-255
Classification Level Classification E-value
Superfamily TPR-like 0.001
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VA64
Sequence length 537
Comment (tr|Q9VA64|Q9VA64_DROME) Prolyl-4-hydroxylase-alpha NE1 {ECO:0000313|EMBL:AAF57058.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9728 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRGLVLLVGLIFLLAQGSLASDYFSSITGLEDLLHTEQYLTRELRSKVNAIQTALQQLES
ELSSIEKEHTMAASDTENYLTNPVNVYRLMKRLHTDWSLMEGRVQLMAEEMNFNATREYG
LSYPSQEDVEGAALALVRLQSTYKLDVAQVAQGILNGVKYGSDMSWQDCFELGQQLFEME
DYNNTKVWLRESMERLRRQTSHAPSHLAPTSGPDTVTLNKMEATAKSLFQLGDFDTAFEL
SQRVLQFDPKRIRNWHLGDKGTAPPEDIDDVYLPKHSDSYSLSQEFAKYEKVCRGEVHPI
VRQELRCRYSRGNHPYRFLAPLKLEEHSLDPYVATFHDILSPGKISQLREMAVPRMHRST
VNPLPGGQLKKSAFRVSKNAWLAYESHPTMVGMLRDLKDATGLDTTFCEQLQVANYGVGG
HYEPHWDFFRDPNHYPAEEGNRIATAIFYLSEVEQGGATAFPFLDIAVKPQLGNVLFWYN
LHRSLDKDYRTKHAGCPVLKGSKWIGNVWIHEVTQTFARPCDVFRDHEVSLEYEIIK
Download sequence
Identical sequences Q9VA64
FBpp0085050 FBpp0085050 NP_733374.1.81976 7227.FBpp0085050 FBpp0085050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]