SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VBQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VBQ3
Domain Number 1 Region: 416-475
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000265
Family UBA domain 0.021
Further Details:      
 
Domain Number 2 Region: 71-164
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000182
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number 3 Region: 325-391
Classification Level Classification E-value
Superfamily UBA-like 0.000000000187
Family UBA domain 0.038
Further Details:      
 
Domain Number 4 Region: 470-515
Classification Level Classification E-value
Superfamily UBA-like 0.00000681
Family UBA domain 0.024
Further Details:      
 
Domain Number 5 Region: 212-345
Classification Level Classification E-value
Superfamily TPR-like 0.0000911
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VBQ3
Sequence length 614
Comment (tr|Q9VBQ3|Q9VBQ3_DROME) FI08017p {ECO:0000313|EMBL:ACR10178.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5111 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSQINNIFIKLRARLRERDIKLWEEPYYFEEVGSIESEMDRLARDISGELGISVSDCRIA
LGELQDGALRKLAARREFNDTGLATFNVRCVDSKGGTVQMLEIKCSLGGLGSDLQAEVAK
KLDIVDSSHVKCISGGRIINGQKTLASQGLKTNQHLMVVVGGTNEGQELHERIQRIRADL
ELVADADRFMEMEDQDGRPIFLPREENRSLLMAMSMYEVARVAMHKENFDEALLILLEAD
ELFSQCDSKLLEGVDNYALINLDIVWCYLRLKNITQLPDAQRRLDICERGFVKSYGEQFI
RLFSIKGPSSPERALIMRLHLLQGVLLFHQNRRDEAYEKLEVATKDLYEVKMNDTELSTL
VEMGYEESDARLALRSCAGQVDRAIQYIQERSERISEERKNSAAERQVNQEMIFAGQGGE
WVNPRSIIRLMEMGYERRLVVEALKRTKNNLDRSLDLLQRHSDELRANLPPIPPVDESLL
TTLQHLGFSEISARDALETTGNSFHKSLKFLLKSFPNESELLHVIETMTKVLEVQEPTSS
TNATANSTTPLVNLSNSKVNLLQTVLSEAKSEIESYNAFKRFNENLAENNNHYLNLPLDQ
EEQILIEYKRLLEG
Download sequence
Identical sequences Q9VBQ3
FBpp0084254 FBpp0084254 FBpp0084254 NP_651402.1.81976 7227.FBpp0084254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]