SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VEQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VEQ1
Domain Number 1 Region: 82-239
Classification Level Classification E-value
Superfamily TPR-like 1.23e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VEQ1
Sequence length 282
Comment (tr|Q9VEQ1|Q9VEQ1_DROME) LD10670p {ECO:0000313|EMBL:ACY07077.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG17556 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIA
ALDTARFDIATKCTKQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAA
PRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVL
LHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNS
RAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEIKSN
Download sequence
Identical sequences Q9VEQ1
FR693 FBpp0082818 FBpp0082818 FBpp0082818 NP_001262652.1.81976 NP_650581.1.81976 7227.FBpp0082818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]