SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VFH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VFH8
Domain Number 1 Region: 77-153
Classification Level Classification E-value
Superfamily TPR-like 0.000000011
Family Tetratricopeptide repeat (TPR) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VFH8
Sequence length 374
Comment (tr|Q9VFH8|Q9VFH8_DROME) RE63320p {ECO:0000313|EMBL:AAL49194.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14853 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSNLLYMDKSNGNGVYAVRPNSSNGHMDNDNGLNGSGAPATTSTTTGTATAAGAALMATA
NNINIMNGAAAAAAASASGLPTSASSEDLSQSLSEYTDADESVSAPTEFLAEFLSAVMLK
DYKKALKYCKLILQYEPDNATAKEFYPLILDKLRAVATSSDSDENYNKSSSPDLALDLHA
SDVEADVDGDEAGDADEDGDADADGDGSESSNNCSEEEDNGWGDDEIDNVDVMDGEEESS
SSGDDFDLPIDDAGQDPAALAVHVHHSHTHSHSHSHNDSGSSRNSSSGGGGRSDNTTHSY
SSLLLEEEDDIVPVSLNFGLKENTAADLDVSNGNKVPSASCSDSESPTEPLTQRLAAILR
SKCGVSGGGSDETY
Download sequence
Identical sequences Q9VFH8
NP_001262573.1.81976 NP_650376.1.81976 NP_731925.1.81976 7227.FBpp0082420 FBpp0082419 FBpp0082420 FBpp0082419 FBpp0082420 FBpp0306145 FBpp0082419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]