SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VJR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VJR9
Domain Number - Region: 136-272
Classification Level Classification E-value
Superfamily TPR-like 0.00109
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VJR9
Sequence length 364
Comment (tr|Q9VJR9|Q9VJR9_DROME) IP11532p {ECO:0000313|EMBL:AAY54804.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG4697 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDNGEETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDE
LYKTLCVEVDRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLML
QELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMF
RNLIRVSIYMENWWHVLTYIDEAKQYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQ
YFLSTPYGRYDYDKIVAPEDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWT
ILAKFYAGEFDACMTLLREIENHVRLDVYLSPHVSALYDLIMARMLKKRNREVMTESVKK
RKSR
Download sequence
Identical sequences Q9VJR9
FBpp0080233 FBpp0080233 FBpp0080233 NP_609720.1.81976 7227.FBpp0080233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]