SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VK45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VK45
Domain Number 1 Region: 564-1211,1249-1477
Classification Level Classification E-value
Superfamily ARM repeat 5.08e-113
Family Armadillo repeat 0.029
Further Details:      
 
Domain Number 2 Region: 2016-2180,2215-2357
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.95e-98
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0038
Further Details:      
 
Domain Number 3 Region: 1940-2033
Classification Level Classification E-value
Superfamily FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 3.4e-40
Family FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 0.00000568
Further Details:      
 
Domain Number 4 Region: 6-204,347-609
Classification Level Classification E-value
Superfamily ARM repeat 1.19e-27
Family Armadillo repeat 0.057
Further Details:      
 
Weak hits

Sequence:  Q9VK45
Domain Number - Region: 1661-1764
Classification Level Classification E-value
Superfamily TPR-like 0.000303
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VK45
Sequence length 2470
Comment (sp|Q9VK45|TOR_DROME) Target of rapamycin KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Tor; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSTTSVVQQFVNGLKSRNRNVQNKATQDLLFYVKTELREMSQEELAQFFDEFDHHIFTMV
NATDINEKKGGALAMKCLINCEGSLTARKGISPYLNRLRDLLLINDVSVMEIAARSLVKL
ANMPTSKGADSFDFDIKKAFEVLRGERQEYRRHSAVFILRELAIALPTYFYQHILTFFEV
IFNAIFDPKPAIRESAGEALRAALIVTAQRESTKQSSEPQWYRICYDEANGSFNADLGSS
KDQKGVTRDDRIHGGLVVFNELFRCANATWERRYTSLKTLFPKTQHNKFLEASSSSSMGS
QLNTLVPRLKVPFIDKLGSTQTHLGEGEHHKGVAKFASHNVLESAYAQEILQEHYTSICD
NVLEQRTSKSPYVQQALLQILPRLAAFNRAVFVEKYLQTCVSHLMQILRGKEKDRTVAYI
TIGYMAVAVQSAIEVHLSSIMTSVKVALPSKDLTSKRKVPVDPAVFACITLLAHAVKSEI
ADDVKDILEQMFYTGLSPALTVCLRELSENVPQLKSAITEGLIGILSQVLMNKAAILPYT
ALPTIAIDGSLMQNGDGATTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLEA
VQTCTRLLKLAVQSSESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETFD
GKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSINPAYVMPKLRTTMIELITDLKYS
GMSRNKEQSAKMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDLA
EVNGGSDEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVTPYHKYPVL
IDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVDE
SQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIKC
VPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMGDIFKLIKEFWTINT
PLQNTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGST
LGYYLPLILPPIVKLFDSPYVPQQVSMVALETINNLACQLDFTDFSSRIIHPLVRVLDAE
PELRDQAMTTLRSLAKQLGKKYLVFVPMVQRTLNKHRIVDPEYEELLSKIKSCSTLADSY
GAGESELRPSRFKNNEPFVTDRNSNNKNLQVTTNELRTAWQVTRRVSKDDWVEWLKRLSI
GLLKESPSHALRACRSLAQEYDTLLRDLFNAAFISCWTELSPDLKNELTQSLIQALQVTD
MPEITQTILNLAEFMEHCDRDPIPIETKLLGTRAMACRAYAKALRYKEEEFLLREDSQVF
ESLILINNKLQQREAAEGLLTRYRNAANELNVQGRWYEKLHNWDEALEHYERNLKTDSSD
LEARLGHMRCLEALGDWSELSNVTKHEWENFGTEAKSRAGPLAAVAAWGLQDWEAMREYV
RCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVCV
QMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHEDIHTW
LKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPNQPLPCNQPQVTYAYTKYMAANNQLQEA
YEQLTHFVSTYSQELSCLPPEALKQQDQRLMARCYLRMATWQNKLQDSIRPDAIQGALEC
FEKATSYDPNWYKAWHLWAYMNFKVVQAQKSALDKQQPPGASMGMTMGSGLDSDLMIIQR
YAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYEALLSGMKLIEINTWLQVI
PQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDSMR
KHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAMLE
RGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQLT
SLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISIIKTNLQVITSKQRPRKLCIRGSNG
KDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLIGW
VPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEHALGQTQGDDL
AKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHIDFG
DCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAVLE
AFVYDPLLNWRLLDVDKKGNDAVAGAGAPGGRGGSGMQDSLSNSVEDSLPMAKSKPYDPT
LQQGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTEKSVNEQSQVELLIQQATNNENLC
QCYIGWCPFW
Download sequence
Identical sequences H1ZYB5 Q9VK45
FBpp0080003 FBpp0080003 7227.FBpp0080003 FBpp0080003 NP_524891.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]