SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VKG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VKG0
Domain Number 1 Region: 882-1012
Classification Level Classification E-value
Superfamily TPR-like 2.22e-16
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VKG0
Sequence length 1058
Comment (tr|Q9VKG0|Q9VKG0_DROME) GH18077p {ECO:0000313|EMBL:AAM50187.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6614 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDRKIRNTLRRTARLTKRRRSAGGNEISRNKAVEQRTVEIPLDQRQAPQQRVFLYIQLNE
MSKLPETGNPLELHLYHPKNTLQKMQERYTTDTIIYQHEFNLKKPVFAMGVMQDDIEDMN
TFSDQPLLISLYQRIPRRRKGGSGKGKSRKHGRTSSSREINQLITDALESKENVLKERSS
KWSSERDGEEGGEEGEGGTFSEERLELLSRGHCDLLQLFQRRRFISDITIYLYPEYRSKK
INDKMTTCSVWHMYSILPILKNFNFTNLAFLTLESIYNVPEDLHSKSAELGLSVSFRSTQ
PEESDGAFRVVPLCTYSGFISQIISDQNTIIVWENIKRDLHLNMNFSFNQMETNSRVKLP
KLFRMLLWEQDVDFQIHKIDPVSDLALINNSLHRFVLNEQMRKILEEAVVHNDYELLLQL
YQETPTNVLYEGVINPSIFGYPGVNYCRFACRLNPVFEPSIKLSLPRDTLVMGPMFCTFK
ICFFQPICERNEPLDQYNESLLKRAKLRRCFDMEFLKEDETDGDVLLELYRAFDDLITDT
IEFIIKRDVQDINDRKEFFCCQLGNICNLVLKICGCDFNVRMPTKTNIEFREMLTHMYKE
LMDRIEGVFTACCWKNNCVTTSNQDQEEHGLNRMMNEMRLVSNTGQRDLAIHMYDEIDHS
TTNRIVFDFVTLLNSVENLQFEQAARYFTKPRTTDWSGYYFTLILQLYINYMMDLRSTDE
EVVSTVKSNMIESLRQFANKNSLESEIWILLYCYYKEHSYLPGMELTRWKFQNLTKITPK
ALNYTPTSLYELYLPVDFEMKSSSTPMNTQFYPVFKLFARLGAYAFAEVIFSEIEQCFTE
AEVYLIRTTLKILQRQIDDKFQIIKMPTDNSVYGKLKRCYQLHINGSVEYSRGRCDEALK
YFQELLSVVDPMDNLLFKLSFLRLGQLALQRKQYELAEKAFNICLPARRKNFIANYGMGL
TLYHLNRLEEAIPYLSRCTEVDIFIPDVWGYLATINLRLSRNKTALECWKVAKLYPEVSI
SKSVYAELDKIQYSDVHLLVDDDGNPAEKMTKMDFIPL
Download sequence
Identical sequences Q9VKG0
NP_001285845.1.81976 NP_609511.3.81976 7227.FBpp0079851 FBpp0079851 FBpp0079851 FBpp0079851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]