SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VL07 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VL07
Domain Number 1 Region: 679-770,828-1031
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.42e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 291-400
Classification Level Classification E-value
Superfamily TPR-like 5.69e-20
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 110-249
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000464
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VL07
Sequence length 1136
Comment (tr|Q9VL07|Q9VL07_DROME) Utx histone demethylase, isoform A {ECO:0000313|EMBL:AAF52897.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5640 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGQLTFEDDCLIRELDSRYYGFLDLSNSKNAELRNLVQQTITNLQNYIANGQVHESKNSS
DNKNAIQKFEPSTQAGEHMENTSSRNNDDTKPFEQDAKEKVSIIEEKHQDEHYVNALCKL
GHLHLLLGEYSEALSAYQKYLRFRENNYWTNHAFIYGIGVAYFKLRCFKWAIKSFQELLY
LSPNFTCANEVHLRLGLMLKHCGEFHIALKHLQLALLYTYPSTFSELQVKFQIAHLYEVQ
NKHKAAKDGYEFLLNEKNISLELKADVYRQLGWMYHCVECLGEKKEREANALNFLQKSIE
ADPKSGQSLYLLGRCYAGINKVHDAFLAYRNSVEKSEGNADTWCSIGVLYQQQNQPTDAL
QAYICAVQLDKDHKAAWTNLGILYESCGQLRDAYACYLNATKQISFQKSSLIRKKQAIRM
KKDTIGLSKGLSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTA
QMLPRQVTKQSPVQGPPPPYPHSQLSQSPIPSKRIKEDGTSQQEVTQNNSQTSAQNLINI
SESLNQRNFNAMPESNKSSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHD
FIGGDNADISTTFKIQMDSKQLMVAVKLLPIDEPPVHCTILQVNAPPPSPPDCPPQKLTR
DQLLPPTPSVHLENKKHAFSPQLQEFCLKHPIAVVRGLAGVLKLDLGLFSTKTLVEANPD
HSVEVRTQVHQSPDENWDTSQGKRVWACISHRSHTTIAKYAQYQASSFQDSLKLILPQDE
SDKGFPGSQAMSDSDSKDSVSNSNIVLKRKKHKINSKMLRFGTNVDLSDEKKWKPQLTEL
QKLPAFARVISAANMLSHVGHVILGMNTVQLYMKVPGSRTPGHQENNNFCSININIGPGD
CEWFAVPDAYWGGVHNLCEKNNISYLHGSWWPVLEDLYKENIPVYRFIQKPGDLVWVNAG
CVHWVQSIGWCNNIAWNVGPLTARQYSLAIERYEWNKVQAFKSIVPMVHLSWNLARNIKV
SDTKLFELIKMCLLQTLKNVLHIQEYVKSKGVEIRFNGRGKNEASHYCGQCEVEVFNVLF
IKEQEKRHVVHCLSCALKLSPSLQGIVCLEEYRLSELQRVYDSFTLHRTQGLAYTQ
Download sequence
Identical sequences Q9VL07
FBpp0079665 FBpp0079664 FBpp0079664 NP_609368.3.81976 7227.FBpp0079664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]