SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VL78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VL78
Domain Number 1 Region: 11-125
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-40
Family FKBP immunophilin/proline isomerase 0.0000118
Further Details:      
 
Domain Number 2 Region: 248-395
Classification Level Classification E-value
Superfamily TPR-like 3.35e-29
Family Tetratricopeptide repeat (TPR) 0.00006
Further Details:      
 
Domain Number 3 Region: 124-234
Classification Level Classification E-value
Superfamily FKBP-like 7.27e-25
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VL78
Sequence length 439
Comment (sp|Q9VL78|FKB59_DROME) dFKBP59 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=FKBP59 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPEGNKIDLSGDGGVLKEILKEGTGTETPHSGCTVSLHYTGRLVDGTEFDSSLSRNEPFE
FSLGKGNVIKAFDMGVATMKLGERCFLTCAPNYAYGAAGSPPAIPPDATLIFELEMLGWK
GEDLSPNQDGSIDRTILEASDKKRTPSDGAFVKAHISGSFEGRVFEDRDVEFDYGEGKAI
GIIDGVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEE
WKLSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNILPTTVHTNEEVKKIKVATH
SNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINELEDALEDFQKVIQL
EPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAANDKETEPPRETDVLSKCGEWSE
EDAKREAELTLERDNIIMI
Download sequence
Identical sequences Q9VL78 X2J5E8
FBpp0079468 FBpp0079468 FBpp0079468 NP_001285784.1.81976 NP_524895.2.81976 7227.FBpp0079468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]