SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VPP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VPP9
Domain Number 1 Region: 256-540
Classification Level Classification E-value
Superfamily TPR-like 7.97e-22
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Weak hits

Sequence:  Q9VPP9
Domain Number - Region: 9-39
Classification Level Classification E-value
Superfamily TPR-like 0.0759
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VPP9
Sequence length 549
Comment (tr|Q9VPP9|Q9VPP9_DROME) Bardet-Biedl syndrome 8 {ECO:0000313|EMBL:AAF51496.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13691 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MASAMLATLELDYFRAVSLYRRRSYERCAELCNALLQAGHDGHVQLFTTKEEEEEEQHQQ
QQAEHSRFGSNLQRIGPRPRGAAGGGAGAVDSGPSIMMPTWLMEGVWQLKMRALTQRVYV
DDLDEDDGGNEATEEVEFERIATAARPGSSIKTAFQPRPLTSQRAQQARSRGAGVAHSSD
GRLNSSRPGSAAVARPGTSLSRPGSSLGSRCGTASRIRATSAAAFNVGDATSKLYQASRL
NPTIYAERETLVKALFQFLYYHEADVQKAHSLCQAVLEVERQKPSGSTGCTLSWWWQQQM
GRCLLALHYPRRAEPFLQQSLTSFPHPDTYLLLSRVYQRIKQPERALLVIGEVVDSRPFD
VTYRLEQARIHQAMEQQEDALQLYRLAAKLHPINVESLASIAVGYFYDNNPEMALMYYRR
ILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQKSDIWYNLSFVAVTSG
DFNLAKRCLQLCLTSDAQNGAALNNLAVLAAQSGDILGAKSYLNAAKDVMPDAAEVTTNL
QFMDVHYKL
Download sequence
Identical sequences Q9VPP9
FBpp0077718 FBpp0077718 NP_608524.1.81976 FR710 7227.FBpp0077718 FBpp0077718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]