SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VQE9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VQE9
Domain Number 1 Region: 505-851
Classification Level Classification E-value
Superfamily TPR-like 2.19e-37
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VQE9
Sequence length 859
Comment (sp|Q9VQE9|TMTC1_DROME) Transmembrane and TPR repeat-containing protein CG31690 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31690; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MHTPKCRRPSMSATLSHKDLAGLAGCSALAFVLYLNTLNAGFVYDDRRAILANGDVTGAR
PLANLLRNDFWGTPLVDSGSHGSWRPLCVLSFRLNYLAGGMTPLGYHLVNVMLHCVATWL
VFLVARTLLPSRMGVLAAGALFAVHPAHTEAVAGLVGRADLASCVCYLLAYLSYRRHMLN
REWGSLILTIMLALAALLCKETAITALLLCGLCDVLSPVGRENSDKVCDGSISGLASFNF
QRRFRSLSILGFTLLCGLYCRLSLLPRPSTAFSAADNPTAHESCFWTRTLTFLYLPVANF
GILLWPQELSFDWGMEAVSRIRTLWDARNILTAGFYGSLVAILWKGSGLRSAASPMDFAE
VANISLPLLRRLGGNSCHTWLGLTCDCHHQLSAPSYRSASAIYSTSSKSKSASWTAAPIL
GTAFLVLPFLPASNLLFYVGFVMAERVLYLPSVGYCLLFGLGFGHLWQRVNSSWRSRLML
LCGLALLLGVHGVRTFRRNLDWRDEEQLFRSAISINPPKALGNLGSVLSAQGRYEEAELT
LRMTLGHRPTMADAHFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLG
DHRQEAISVLRTGARLEGSGVRDRGAHVEARYTCYLQLSVLYRSDGRLQDAAAALRESLK
ALPLLPQKQRAVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAAYVTYGQTLARNGS
RLAEAESWFKRALQLAPLEPSSHHHYADFLEQQERHHEALGLRLRAAALAPQDYTLQSCV
ADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVACYHKALELQPG
HAISRANLARMNVHKHENE
Download sequence
Identical sequences Q9VQE9 T2GG64
FBpp0290896 FBpp0290896 FBpp0290896 NP_995615.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]