SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VUJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VUJ4
Domain Number - Region: 48-197
Classification Level Classification E-value
Superfamily TPR-like 0.0184
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VUJ4
Sequence length 262
Comment (tr|Q9VUJ4|Q9VUJ4_DROME) Regulatory particle non-ATPase 12-related {ECO:0000313|EMBL:AAS65003.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11552 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSNLYTELKNEWSKHAPNLTHCSRLLDGFKLELVRSNFGTIQTASSSKQKDQLIKSREML
EIAVEHSITIKDYAAFERYMAQLNTYYYDYDKYLESSKHMYKFMGLNLLYMLATNRLADF
HIELERLPTALLLHDSFIQPVLALENYYMEGRYNKILQAKKSMPSEIYSNFMDILVNTAR
EEIASCMEKSYLKMAPKLAAQRLGLRPGSKELFELATKRQWCLDEEGNYDYAGLHTRPME
KVPAKDIATHNLTYAQELEKIV
Download sequence
Identical sequences Q9VUJ4
FBpp0075422 FBpp0075422 7227.FBpp0075422 FR100 NP_996086.1.81976 FBpp0075422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]