SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VVM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VVM8
Domain Number 1 Region: 496-630
Classification Level Classification E-value
Superfamily TPR-like 2.96e-19
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Weak hits

Sequence:  Q9VVM8
Domain Number - Region: 431-523
Classification Level Classification E-value
Superfamily TPR-like 0.0721
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VVM8
Sequence length 798
Comment (tr|Q9VVM8|Q9VVM8_DROME) FI02004p {ECO:0000313|EMBL:ACU68947.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5290 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVADIFSEYYICNFNDAVTVEDLPADETLRQLWTRQKLWTIDELREILQRWQEHVKPDPN
DNPTSQLKDFLLLIFAFVQNSFTGPFDKLEEYQQIHSELELEKLDALEKLKASGEELNPN
VKSVELLLIAREILEGLLENHPESKVLIWWRLRLICLHQHVLDDLAASLYEQFKSAAGHL
QAHFNQFESRELQSLLLLELANGYLQFHRSEIASQILDELCKHLQVELKVEGLLGVRTKF
QQKALPQLCLKVEHLNEQQPLPPAVQTNETTKLPKLLLLEDDTRLERIRFVELKDNEVMT
LPSVLQALVLAKVKQLKRSTPKDRLADEQLEPYTQTLLYQEHGPFQVRQSALLLNCLQES
NQRRTVERSWKQCEECVKLLDTSEEELSLRSRLSYGFAAHLSPKWQVQLQLVDLLRSLGM
TKTALDICLRIHAWQQVIECYTSLELRHKAAEIIRQELEKKPTALLYCLLGDAIDDPSFY
EQAWLYSKKTSGKAQAYWGNHFYRSADYAQAMDHFEISLEINNLQEAILLRCGYCAIQLE
RWEPAVKYYLAYTHLEPNGFESWNNLAKALIKLGDKQRAHRVLGEALKCNYSNWKVWENY
MLVSVDTSHWDDAMRAYQRMAELKQHYLDQEVLTRIVYGVSKEDPAGSSALIKRLIKLLG
QQSIQHGNEPLVWELAALVAQTPLKKAEKLVKSYRAYTPKHLGWETKSEHALKALDLCLE
VCDLSVAAITEHIQEESEVMITSQLNSARLAGTSCLNALKRAINVDVSAEQTAKVEQLEK
RIEDLTKIVQERMNASRS
Download sequence
Identical sequences Q9VVM8
NP_649026.1.81976 FBpp0074918 FBpp0074918 7227.FBpp0074918 FBpp0074918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]