SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VW22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VW22
Domain Number - Region: 431-523,571-625
Classification Level Classification E-value
Superfamily TPR-like 0.00141
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VW22
Sequence length 1319
Comment (tr|Q9VW22|Q9VW22_DROME) Lethal (3) 76BDm, isoform B {ECO:0000313|EMBL:AGB94751.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG8793 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLHLTGQSYNARDIIRNIFSPLIGVLSSPQADEICHRNNLSFVELLQPFAKLPNDAHFRD
VSGTSVSVRGLRLNFCDVDWRPPQTILARKMLNESVTNAHNDKTRLATIAGIDLELPTSE
PWFEQWRETFLTVQFPADHEFTRHLLSCLLVLSSADPQIVETAHKLGQRVQQMQSITPQK
LPKWFHPTEVLNSYVVLHEASQGDLSKAQQGFELLKSTFGDSKCFLVSINSMDSQGAAEV
PDHWATFIKRQPKSDPNLPSTDLSAPKSPQEAVSVISMPAMQMSQLLEGVSAQDSDLAML
HPLSPMQESATEAINSKFSISSESIASQTINPNVWGNELEADAPHGGCLTSRDIDNLRHF
VQDYAVRALIPYIEHLVAILAEGVTNKKGVSKSLLSATKRWFVTSKPGAGANNQNAVIYT
NESAELQTRKLGDLYFMFGHYNLAFQSYHQAKRDFNADSAWQYYAGALEMAALSAFMLGT
AQRKTYDYMEDAIVCYLTVCKLQQFATRATLLSMECLKTARLYSEVAKQLIRMTNEESDL
RSALLLEQAAYCFLVTQPPMHRKYAFHIVLAGNRYSRAGQRKHAYRCYRQAYQVFQKREW
SLAEDHIQYTVAKQAYMLKQLEEASRSFAHLLRPGSLQSAQQQTSFLKEYIQTQNELVKR
SPELGLLPHALPQVVQSSVRVLTLVQSPSAVAPHVPATNIDINSNLTADEPIWNKIEEML
VITAANNKPFVFKPSRYLYTKQQPALETPVAVQGEPIELAVTLSNSVQCRIALSEIDLLW
KLTLDNDEVLSNACTYEESSDSANKIAVGAAIKTSCMASIKLAEQAEETLHFKLTPKLTG
RLSILGVVCRVAAGADPAASLLGTLQFETQKIRPHNAKQSSQTVMDNRLTIKLVPQLPAM
NVSFTPVPNRLLAGEIVPVHVTLRNMGIAPIEEIYLGCDNPRCVSLLDQHSQMPLAMMSS
LRNLSNDKLVKDKEIRGQRVYRLLNRPGLAALDAQQVQTISLWVQAPHQAGPFTLRLLFY
YSLPTVANSPIKYRLVRHIWQLQVESCLQADSTCVVSNAVTNELGLDVNVRNQHAVEGTE
VYINSISLYSTEFKLNPDRLHIMNSMGVSPGQAGAQCLKSSICCNFQCRLLEKETQEEYK
DIPSIKTLLHSRLSHLKILPAQHAQQVEQHMPPIHDPHSFLTNEETVYFNTNISTEEFNA
SVADYVPHATLVLSWSALVAREEGQRLACGLHFIKLYKLFETGHCPAAPTASFLRRRHSS
DDTLDNRREFPLPEGALNNEDAWQPLADADEEDYWEPNENYVGQRCLLEDESFVMAVKA
Download sequence
Identical sequences Q9VW22
NP_001262058.1.81976 NP_649135.2.81976 FBpp0074734 FBpp0306028 FBpp0074734 FBpp0074734 7227.FBpp0074734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]