SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9VXG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VXG8
Domain Number 1 Region: 2136-2287,2319-2488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.03e-79
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 665-775,862-1218
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000896
Family HEAT repeat 0.043
Further Details:      
 
Weak hits

Sequence:  Q9VXG8
Domain Number - Region: 1517-1537,1806-1871
Classification Level Classification E-value
Superfamily TPR-like 0.00228
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number - Region: 1347-1409,1524-1548,1617-1662,1922-2147
Classification Level Classification E-value
Superfamily ARM repeat 0.0105
Family Armadillo repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VXG8
Sequence length 2517
Comment (sp|Q9VXG8|ATR_DROME) Meiotic protein 41 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=mei-41; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSTQRKDMWKLLYNHVNRNVSNFSGVYSVIEDILCQEPSLISCSLVRELHNKFQDTFLLW
LLNKLAKCLSESPDSSECINLQRKILSSCCSNHPKLFERLVLAYVEAIEETHLQLSSLDL
GQLSNERKPAITVRIFRCDVECLQEFDPHCAIEDIKVPLEQADMYAKSLLEVLQHAHHIG
YATHGDIFSGSLHQALLILKECDMDTKLASLNYCHNVLRSQSASSWITNPDVGHYAQLTL
EATAIMWSAVAKWLDMGCMTRQELKRLNITTKLLLEVLHMRARPAHHLGYLLLNEILSLP
TAIELDDGLLETLSSYIQGQLEHSVVPLEQLVHLQQLMLSHWHCHPTHLVPILALMGLKQ
TEMRSGVVQVLTQSLVEILKKEEVLSKDWQKLIAILRGFKQLEKLILSQSQHKIAEHEGH
IDSSVLAMLPLQCEIIKVADTNWNNLSMQLVELESKCSADRRHIHLEICSLLMQITFIRH
FLKTQTQHQLLAILQRHLKLSYLCAIRLETPSSVHTQMQSFYAQQYMRLFQSEETQEIFC
SNLPQLYISGFIKPEQLMKALPTINNRSGRAQVIRLLLCSQPGKLSVFKVKDRIELYCPK
CRPLPKKLPGIYLGKCKQQLPCPDFSSTNLEMIANDLLFYPDFECIAQHLDLLCFEPNVI
LGLLRETEALQKVSVKVIGQLVSAMRVRSPEFLEQLANLVLAAIKAMLAKPLTEQNVLQQ
RSMLNVLTAIAHMEDNEIWLFHWFKMTFFFLVHTRSLVAQEAVLAATEMCASQGLQTIHL
WNWYKRDALDLTVRLALNVYLLDGVRFTRSLRALTKMLGFTCVQEFTCKYHRLLTAMVLP
HCIVNPLCKGVLVLIAKQMQKHIGTLFSISFLRIYTHVFLTEEPELANSCIELVVSCTQS
SLQQLMNADVKQTVAELLIYFNRNPTFVMRSFQSLLQLSIGSLEELSSQTANAEFANFIA
ERFLGVITYFESCLSEPSFEKPLKEETLYSLGQIMRFVGSQHVTQFRFKIIAMLSFVHTL
QEPRLQRICLKIWHIFLHVVNVQELGPSLGRIVATLQPLLADNESVKQVNDLYEFIILRN
ASMLGTFITDLYFLDRMENVSPSIQKCIRRHTAHLDLKGLAEEENQSPPLVDQLRFLQKH
ITDECLQVRVYALQHLGDLFGRRRPKLNSTILSELPLEPMLEQIVNVLMAGCQHDDSQLQ
MASAKCLGELGAIDASYLPSNYNFASPQHLPLNILSDDFAVLALTSLCRGYQFQQNTKHV
DSFSLAIQETLAICGISPKEQKKVQLWQSLPARMRQLMEPMLHSCYTCVHRPSTCLQQPL
FGSHYSHNYYEEWAFLWASRLIDYLPSSGRRHLLSSYKPCIKRDSNMLSTFYPYILLHAL
LECTTEQRNHIQEEFMAVLQANEESSSSVRGRQELGAIKENAFKQFESRKYAAGIKPLAS
TLVSDRKEDSSRVPRLAGKLCAELLDFLQRWLREWQRIHGRSTGGKPPETIDSNYRKIHE
FLNLIPKLLVSRASYNCGEYARALSYLESYLEEGEDKSQRLLEQFTFLVEVYGSLRDPDS
VEGAVQVRSYDMSVTQDILVNRLVERQQDMITSYEQLLSSTDQMQPDHVRAMIDAYLRDT
PKTAQLIADGLWQRLSDRYSDQCFAECKSELLWRLGSYDEMEELQSNWPAQCSQGCLKLR
RPLTTRIEFDSLLDGMRESVLEELRSCSAVQQHSYANAYDAVLKLHLVHELHCSQELVEK
LEQDRDEDNQEKLMKNYFDDWQYRLQIVQPQVRIQESIYSFRRNILAELQRRLTDRNHLL
PHLKTELARIWLNSAQINRNAGQLQRAQLYILKAAEYQPSGLFIERAKLLWQKGDQVMAM
NYLEEQLSIMRSGCQGNVKQLAAEQRHLFFRGKYLQAVYSAESMHLCADAVLKYFQEAIA
VHRQSESCHVQMAQFLEKILEARQGGKSEPTGEQDDMLINVMVNYAKSLRYGSEHVYQSM
PRLISLWLDTTESSTNTEQVKKMNDLLTNCCTALPTAVFYTVYSQMLSRLCHPVNDVFTV
LRNVIIKLVEAYPQQSLWMLLPHFKSAKAHRIKRCKLVLTDSRLQNSTFQKLLQDFNSLT
ERLMDLTNKEVTLDRTYKLSDLDTRLSKLCKQPEFSQILLPFEKYMQPTLPLNSDSNSSE
GSHLPANQSTVNWFPYQQIYISGFQESVLILRSAAKPKKLTIRCSDGKDYDVLVKPKDDL
RRDARLMEFNGLVKRYLHQDAPARQRRLHIRTYAVLPFNEECGLVEWLPNLASYRSICMN
LYAQRRLVMSTRQLQSLAVPLHESIERKREVFTKQLVPAHPPVFQEWLRQRFATPHSWYE
ARNTYIRTVAVMSMVGYILGLGDRHGENILFAEGNGDAVHVDFNCLFNQGELLPYPEVVP
FRLTHNMIVAMGPLGVEGSFRKCCEITLRLLKQESKTLMSILRPFVYDVGAQTRKGAATA
KITKDVQRIADRLQGHVKRQQANSIPLSTEGQVNFLINEATKVDNLASMYIGWGAFL
Download sequence
Identical sequences Q9VXG8
FBpp0074047 FBpp0074047 NP_523369.2.81976 FBpp0074047 7227.FBpp0074047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]