SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9W1I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W1I9
Domain Number 1 Region: 75-190
Classification Level Classification E-value
Superfamily FKBP-like 1.47e-21
Family FKBP immunophilin/proline isomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 221-360
Classification Level Classification E-value
Superfamily TPR-like 2.8e-16
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W1I9
Sequence length 455
Comment (sp|Q9W1I9|FKBP6_DROME) Inactive peptidyl-prolyl cis-trans isomerase shutdown KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=shu; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEENFEPYTPQLLKNPLSYSDLVKKGVEFEVDNSQQNHARDLGLDSDSDSDYEDALDVDG
EELRSPWTYSFDELRALMSEIDENIYKRITRTGHVDREAVPNKARVSVRYSGYWEGETAP
FDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPPRIKPKA
DALFKVEVIDYSLIGDAKGIDAIPQEDRDKFCVVYPKAVDLHLHGKDSVKLGRYQSAATA
FERAVSSLNYCRMANDEEERKQTELLTTLNQNLMIVYNKMNKPKRACIMMKALRHLTMGN
PSCKALFQEGRALAALGEYNLARNAYLQAQAKQPANKEISDEIISMNKRISKYEEASRDI
WARAFSLKNSKSDVRKTPAQLEKEAKEQDFNDKMEDLIRRFKNTSDQQVSFSRKSYSNAQ
FDATCKLAKEHNLKLTLSPIQEDVLTLSKPDVKFA
Download sequence
Identical sequences Q9W1I9
FBpp0072146 FBpp0072146 FBpp0072146 7227.FBpp0072146 NP_611837.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]