SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9W397 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W397
Domain Number 1 Region: 247-589
Classification Level Classification E-value
Superfamily TPR-like 0.000000174
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 
Domain Number 2 Region: 92-225
Classification Level Classification E-value
Superfamily TPR-like 0.0000512
Family HAT/Suf repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9W397
Sequence length 602
Comment (tr|Q9W397|Q9W397_DROME) RE67794p {ECO:0000313|EMBL:AAL49255.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7246 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAEFIAEMQERLLPEYEQMKNYSVFTADQVREIVSRRERLFLKINKSHQSITDYLDFILY
EKHMHMTIVDKEKKMHVKLTGLKASIATRIMRLYREALAKFNHDRRLWSNWIKFSRKSNP
VEVAGIYEKMLLYHGDSPDLWVDAALWLYEFNRLNIDRVKDILLRGLQRHPDSEALNKCF
FDIMLKEAALASNERNLAENTLSEQDIKLERVEAVYRNSMANITQLDYFVKLLESCEDHQ
ELTGKLQRMIIDDMQEKFPREPGLWDLLAQRELRGFHLGDLEEEDLDTSDEEPASKKSRS
VNGRSLKRRIQLCVTVYKSAVEELQTTEMWNMYLDAMLALNSDGKTERILKQQCLADALQ
AGHRSQLMGVKHYATLRKMLCTAPSGREAAVTILTEALKNDSSVEMHELLLATHIQSDSE
PLIYELFNKIQKSMGSEALPLWRSVILYYRTRQDSLGARRLDEIYGLACKAAWPEFGELR
SDYLRYLWQERSVEEARKEYAKLAILPPMSLALHRQMVQLESSAAACDQASLKYWRMCYD
FMACYFGKTQPRVWVEYLAFERDHGEAKNISLLTQRALSTLEPQYVAAFEAERALAYVGA
SI
Download sequence
Identical sequences Q9W397
FBpp0071288 NP_572520.1.81976 7227.FBpp0071288 FBpp0071288 FBpp0071288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]