SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9W4X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W4X8
Domain Number 1 Region: 35-61,201-280
Classification Level Classification E-value
Superfamily SET domain 0.0000000000376
Family Histone lysine methyltransferases 0.061
Further Details:      
 
Domain Number 2 Region: 54-104
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000401
Family MYND zinc finger 0.0082
Further Details:      
 
Domain Number 3 Region: 364-464
Classification Level Classification E-value
Superfamily TPR-like 0.0000152
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9W4X8
Sequence length 468
Comment (tr|Q9W4X8|Q9W4X8_DROME) SET and MYND domain containing, class 3 {ECO:0000313|EMBL:AAF45795.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13761 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MATATVGSSRSATTSATASACSSKSKNLKNPAPQIKRGQRILTEKPFAFVLKSQYRLERC
DNCLEATKVLKCSNCRYVSYCHRSCQMQAWGQHKHECPFLKKVHPRVVPDAARMLCRLIL
RLEHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHLDSLHAVLTDMMAESPSTVP
NKTELMSIYGRLITNGFNILDAEMNSIATAIYLGVSITDHSCQPNAVATFEGNELHVHAI
EDMECLDWSKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKESKEMLAALCPNRN
CGAGISVDRNNCPRCDAGISPKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLDKQTGV
FHPLNVWYVKTLDAAFEAAIEVGKWSDALDYGQRLLPGFRKYHGPWNPLLGLLHMKLGKI
QLYEGHSKEALHHLEEAQRILTVTHGRDHRLLTEQLYMLVLQARQEAH
Download sequence
Identical sequences Q9W4X8
7227.FBpp0070431 FBpp0070431 NP_524768.2.81976 FBpp0070431 FBpp0070431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]