SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9W5N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9W5N0
Domain Number 1 Region: 31-155
Classification Level Classification E-value
Superfamily HCP-like 1.83e-17
Family HCP-like 0.00042
Further Details:      
 
Domain Number 2 Region: 127-159,192-248
Classification Level Classification E-value
Superfamily HCP-like 7.59e-17
Family HCP-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9W5N0
Sequence length 266
Comment (sp|Q9W5N0|COA7_DROME) Sel1 repeat-containing protein 1 homolog KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13865; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAYDLKKESDVKEYVEKLGVEYRFGCYSEKKPEACHLLGDYLEGIKKDFEKASKVYKSTC
DDYGYAKSCYKYGNYSFLGKGKSGSKGNPQVAYEYYEKGCNLNDSDACLHSGLLLVSKSM
PREIDWNVPKGLEFLTKSCDLNNATACFYLSGMHISGVQKKADQSAVTASSGSGTSSPPA
GQPPLKDSDYIVLKDMKKAFQFAHKACELRNMYACANLSQMYARGDGIEKNEKEAEKYKK
LALEMQDEVKKQHDTLGFQQGVGMPN
Download sequence
Identical sequences Q9W5N0 X2JEN8
FBpp0110448 7227.FBpp0110448 FBpp0110448 NP_001036323.1.81976 NP_001285541.1.81976 FBpp0110448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]