SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9WVC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9WVC8
Domain Number 1 Region: 521-553,635-709
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000011
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9WVC8
Sequence length 757
Comment (sp|Q9WVC8|S26A3_MOUSE) Solute carrier family 26 member 3 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Slc26a3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MIEAIGNQYVVARPVYSTKTFGEEFKKTHRHHKTFLDHLKGCCSCSSQKAKKIALSLFPI
ASWLPAYKIKEWLLSDIVSGISTGLVAVLQGLAFALLVNIPPAYGLYAAFFPVITYFFLG
TSRHISVGPFPVLSMMVGVVVTRVVSDPNASSELSSSSTENDSFIEEKVMVAASVTVLSG
IIQLLLGVLQVGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFSIFKVL
ESVFTQIQKTNIADLVTSVIILVVVFVFKEINQRYRSKLPVPIPIELIMTVIATGVSYGC
NFEDRFGVAVVGNMSLGFQPPITPSVEVFQDTIGDSFGIAIVGFAVAFSVASVYSLKYDY
PIDGNQELIALGVSNIFTGAFKGFAGSTALSRSGVQESTGGKTQVAGLLSAVIVLIVIVA
IGFLLQPLQKSVLAALALGNLKGMLMQFAEIGRLWKKDKYDCLIWIMTFIFAIVLGLGLG
LAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKNYAEVYEPEGVKIFRCPSPIYFA
NIGFFKQKLIDAVGFSPLRILRKRNKALKKIRKLQKRGLIQMTPKGFICTSDGFKDSDEE
LDNNQIEELDQPINTTDLPFDIDWNGDLPLNITIPKISLHSLILDFSAVSFLDVSSMRGL
RTILQEFIRIKVDVYIVGTDDDFIDKLARCEFFDDEVTDSIFFLTIHDAILHILMKKDYS
TSKFNSSQEKERKFDFTINTNGGLRNRECQVPVETKF
Download sequence
Identical sequences Q9WVC8
10090.ENSMUSP00000001254 ENSMUSP00000001254 ENSMUSP00000001254 ENSMUSP00000001254 NP_067328.1.92730 XP_017170439.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]