SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9WX91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9WX91
Domain Number 1 Region: 1-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.33e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9WX91
Sequence length 407
Comment (tr|Q9WX91|Q9WX91_CLOPF) Nitrate reductase NADH oxydase subunit {ECO:0000313|EMBL:BAA74793.1} KW=Complete proteome OX=1502 OS=Clostridium perfringens. GN=BXT94_11365 OC=Clostridium.
Sequence
MRYIVVGASAAGISGAKTLRELDKDAEIILVSKDENVYSRCILHHYISGHRDIEALDFTD
RDFFEKYNIEWKKGLEVKAIDDREHVIVLSNGESLKYDKILLATGASAFIPPVENLREAK
NVVGLRNLEDAIKIKEEAEKVKNVVVLGAGLVGIDAIAGLAFKDLNVTLVEMGDRVLPIQ
LDKYASSKYEKRFEDAGVKLKLGVRAEKVLIDENKNPKALLINTGEEIPCELIIVATGVR
SNVAFLKDSSIETDRFGLIINEKGETNARDVYGAGDITGRNPIWPTAVKEGIIAANNMVG
NEIFMEDFFGSKNTMNFLGLTTMSLGVVNAPDDSYTEEIDISGENYKKIIHKDGKIYGAI
IQGDLSYAGVLTQLIKEKIHVSKVKKPLFEIDYADFFNIKENLEYTY
Download sequence
Identical sequences A0A0H2YS34 Q9WX91
WP_011590958.1.10161 WP_011590958.1.2058 WP_011590958.1.20964 WP_011590958.1.30163 WP_011590958.1.50147 WP_011590958.1.52260 WP_011590958.1.5234 WP_011590958.1.52659 WP_011590958.1.68380 NYSGRC-SEC-110800143 NYSGXRC-11162i 195103.CPF_2050 gi|110800143|ref|YP_696479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]