SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9WYA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9WYA7
Domain Number 1 Region: 10-279
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.14e-53
Family Methylenetetrahydrofolate reductase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9WYA7
Sequence length 281
Comment (tr|Q9WYA7|Q9WYA7_THEMA) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=243274 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099). GN=TM_0270 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MRKSLEIGKCVVLEVLTPRGTNLGRFMEFTEEAWKTGIDAFTVTDMPMGRVRMAPWAASH
LLVESGKDVLMHFTRNTRNMIRIQSDLLGCHALGVKNLLLLSGDNPSHGDYPETTSVNDI
DILDLIRLTKLMNEGTDLAGNKIYGKTDFFVGGALNPFSDKDIKRAKQKIEAGVDFLVTQ
PLFNSEVAKKIKEELNTKILASIVFFENAKQMSYFSSVPGIEIPDEIVNSTEKGDDYLKE
KSFESVLRFVEETKGVLDGFYIVAIVKDLEKIRKVVEIAKS
Download sequence
Identical sequences Q9WYA7 R4NXT0
282147 APC4129 243274.TM0270 gi|15643040|ref|NP_228083.1| NP_228083.1.35502 WP_004082974.1.29620 WP_004082974.1.45724 WP_004082974.1.51363 WP_004082974.1.56403 WP_004082974.1.79805 gi|15643040|ref|NP_228083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]