SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9WZ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9WZ48
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.11e-57
Family PP-loop ATPase 0.0000283
Further Details:      
 
Domain Number 2 Region: 324-387
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.63e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9WZ48
Sequence length 414
Comment (sp|Q9WZ48|TILS_THEMA) tRNA(Ile)-lysidine synthetase {ECO:0000255|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=243274 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099). GN=TM_0579; OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MLEEGEHVLVAVSGGIDSMTLLYVLRKFSPLLKIKITAAHLDHRIRESSRRDREFVERIC
RQWNIPVETSEVDVPSLWKDSGKTLEEIAREVRYDFLKRTAKKVGASKIALAHHKNDLLE
TVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYARKNNVPYVVDETNYNVKYT
RNFIRHRIVPLMKELNPTVEDAVYRLVSVTHLLRNFVERTVQDFVERNVYFYKDYAVFVE
PEDLFLFLEVTRWVLKEMYGRVPEYEKLIGTLKSKRVELWSGIFVERSFGYVAVGKTVFK
KKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIVNGRERKLKDVFIEKKVP
TFYRDRVPLLVDEEDRVLWVPGIARSDFLPEDVVVELLEYPVGYVKGGTYFEQV
Download sequence
Identical sequences Q9WZ48 R4NYV0
243274.TM0579 gi|15643345|ref|NP_228389.1| gi|15643345|ref|NP_228389.1| 282452 APC4275 NYSGXRC-T667 NP_228389.1.35502 WP_010865151.1.29620 WP_010865151.1.45724 WP_010865151.1.51363 WP_010865151.1.56403 WP_010865151.1.79805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]