SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9YAZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YAZ7
Domain Number 1 Region: 37-256
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 3.53e-38
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9YAZ7
Sequence length 267
Comment (sp|Q9YAZ7|SUHB_AERPE) Inositol-1-monophosphatase KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=suhB; OC=Desulfurococcaceae; Aeropyrum.
Sequence
MIDAEQLRRVSVKVSSETAGLLRDLACSEDLGRVVSGETTVADKRAEDYILDLLRRELGQ
VQVISEEAGGVASKTSDAPIALVDPLDGSTNYLSCITWCSVSVAFADPRSGEILAGSVAP
VYAGMPVSFARGKGCYHGGLKVEDPSIRGSIISVYVDEPGAIESVAGAIGRLKGVRRDFK
VRSLGSAALELAYTAIGYIAVFADLRARLRNIDVAAAVGAVRECGGVVTDAHGQPLRIGV
WRVERVGSVVASLDEALARIAVGGGSG
Download sequence
Identical sequences Q9YAZ7
gi|118431596|ref|NP_148173.2| 272557.APE_1798.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]