SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9YBA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YBA2
Domain Number 1 Region: 2-287
Classification Level Classification E-value
Superfamily Folate-binding domain 4.55e-72
Family Aminomethyltransferase folate-binding domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 280-370
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.13e-21
Family Aminomethyltransferase beta-barrel domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9YBA2
Sequence length 375
Comment (sp|Q9YBA2|GCST_AERPE) Glycine cleavage system T protein {ECO:0000255|HAMAP-Rule:MF_00259} KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=APE_1695.1; OC=Desulfurococcaceae; Aeropyrum.
Sequence
MPVRRHILEDLHRSLGATFGEFAGWSVPMSYEGTLKEHMAVRREAGIFDISHMGRMIVSG
EGATELLERIYTKRVSKTKVGFMSGPTLALNEYARVKDDEMPYRLGEEEWLIVPNAAVAD
AMLEYFSSIASSMGLNVSIRDLRERYALLALQGPGAARVMEEMGGGDLLDLKPLQFRENA
GIAGVTAYIVSRSGWTGEDGFEIIAEVEAAKRIFKAAVEAGAKPAGIAARDTLRIEAGFV
LGGHEYGEDPLRWPCAVSLRYGLGAIDWGKKGFVGEAALRACRREGVRWIRVGLVMKKKY
ARMIPRSGYRLYVDDVDVGWVTSGTFSPVIGRGVAQAYIDSRYAYIGDTIEVDVRGKRGE
ARLQEFPLVPLGSRG
Download sequence
Identical sequences Q9YBA2
gi|118431560|ref|NP_148104.2| 272557.APE_1695.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]