SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9YBC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9YBC6
Domain Number 1 Region: 166-405
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.89e-82
Family CAT-like 0.00000148
Further Details:      
 
Domain Number 2 Region: 4-97
Classification Level Classification E-value
Superfamily Single hybrid motif 3.53e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00036
Further Details:      
 
Domain Number 3 Region: 119-158
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.000000000144
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9YBC6
Sequence length 412
Comment (tr|Q9YBC6|Q9YBC6_AERPE) Pyruvate dehydrogenase complex, E2 component {ECO:0000313|EMBL:BAA80672.1} KW=Complete proteome; Reference proteome OX=272557 OS=100138 / K1). GN=APE_1671 OC=Desulfurococcaceae; Aeropyrum.
Sequence
MGRIVQVKLPDIGEGIAEGEIVEWLVEEGAVVKQFSPLVRVLTAKATVEIPSPYTGRVVR
LLAKPGDVVRVGDPIIEIEVEEGEAPKAPEAAEKPSATVEPPKAEEAAAPPPQAAPAILV
RAPPRVRRLARQLGVDLARVRGTGPRGAITEDDVRRAAAMLATAPKPEAPPPVAEEAEER
IPVRGIKRSMAQSMSLSKSKIPHAYIAEEVDFTELSKLREALKRDAEEKGVRLTYLPFVF
KAVAKAIRKYPLVNSEFDEEKMEIVVKKAVNIGFAVDTPHGLVVPVVKNVEKKGLFAIAR
EIADLTAKAREMRLSLEEVSGATFTITNVGSIGSVIGFPVIYPPNVAILGVHRLVERPVY
VDGELKPRKIGFVSLSFDHRALEGAYATRFLMEVKRLLENPALLFAEDYEFR
Download sequence
Identical sequences Q9YBC6
gi|14601549|ref|NP_148089.1| 272557.APE_1671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]