SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q9ZV39 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9ZV39
Domain Number 1 Region: 111-187
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000863
Family B3 DNA binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9ZV39
Sequence length 234
Comment (sp|Q9ZV39|Y2881_ARATH) Putative B3 domain-containing protein At2g18810 KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At2g18810; OC=Arabidopsis.
Sequence
MVRAFAYEEIGETSTEAHASVEDNKRDRTRRVINYNLRSTTMISSLSKRLKIDECKNQDP
EQNPNRVASSPSLCHVKSKRPQKGVSNKPILDMDFLNEEELEKIDRHYKKISDSDKGADV
ILVNSEGLQRKLKLKRWDMTSTSNYVLGSGWNKVVTENILETGTRLRLWSFHSPDMLFFA
LVLSDPDLAPTKDWECLNLLAKLTVETACLEASQDADTMSSLVSDTELDLELRL
Download sequence
Identical sequences A0A178VYJ3 Q9ZV39
NP_179471.1.80155 AT2G18810.1 AT2G18810.1 GO.8598 3702.AT2G18810.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]