SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0F8D3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0F8D3
Domain Number 1 Region: 52-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.62e-139
Family Pyridoxal-dependent decarboxylase 0.00000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0F8D3
Sequence length 537
Comment (tr|R0F8D3|R0F8D3_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA18182.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10006660mg OC=Capsella.
Sequence
MHYRDFGNVNCNGNGNGIGNGIGFGNSNGNGDVNGSNEKVNGANETIKMKPMDSELLREQ
GHIMVDFIADYYKNLQDSPQDFPVLSQVQPGYLRDMLPHSAPDQPDSLKKLLDDVTKKIM
PGLTHWQSPSYFAYYASSTSVAGFLGEMLSAGLSVVGFTWQTSPAATELEIIVLDWLAQL
LQLPDHFLSTGNGGGVIQGTACEAVLVVVLAARDRILKQVGKTSLPRLVVYASDQTHSSF
RKACLIGGIHEENIRVLKTDSSTNYGLPPESLEEAISHDLAKGFIPSFVCATVGTTSSAA
VDPLVPLGKIAKKNGIWMHVDAAYAGNACICPEYRKYIDGVENADSFNMNAHKWLFANQT
CSPLWVKDRYALIDALKTNPEYLDYKVSKRDEVVNYKDWQISLSRRFRSLKLWMVLRLYG
SENLRNFIREHVDLAKQFEAYVSQDPRFEVVTSRYFSLVCFRLVPLDADEDKCNQRNREL
LAAVNSTGKIFISHTALSGKFILRFAVGAPLTEEKHVTEAWQIIQKHASKFTCNGNC
Download sequence
Identical sequences R0F8D3
Carubv10006660m|PACid:20895672 XP_006285284.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]