SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0FFQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0FFQ7
Domain Number 1 Region: 36-123
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-29
Family B3 DNA binding domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0FFQ7
Sequence length 331
Comment (tr|R0FFQ7|R0FFQ7_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA21067.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10001406mg OC=Capsella.
Sequence
MNMSTMNSEQELAENGAGGSGGGDNNYFYTAEMREHMFDKVLTPSDVGKLNRLVIPKQHA
ENYFPLEDNQNGTVLDFQDRNGRMWRFRYSYWNSSQSYVMTKGWSRFVKDKKLTSGDTVS
FHRGFIPDDNAPERRLKIMFIDWRHRDTHNNYGFGSPPYPTASFYPPPQYPMPLPSYRSF
PPFYHNQYQEREYLGYGYGRLVNGGRYYAGTPLDHHHHHQWSLGRSQPLVYESVPVFPAA
RAPPPPPAPPQPPITRRLRLFGVDVEESSPYVETRGEMGVAGHSSSSPVVIGDDDQLSWR
LPSGEVDASTSLPMQLSDDEDYKRKGKFSEY
Download sequence
Identical sequences R0FFQ7
XP_006288169.1.15642 Carubv10001406m|PACid:20911106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]