SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0FG33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0FG33
Domain Number 1 Region: 14-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-17
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 202-296
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0FG33
Sequence length 298
Comment (tr|R0FG33|R0FG33_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA21232.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10001579mg OC=Capsella.
Sequence
MACNPEFLKCYEERKQESFFKVVNSVAISSENMRAIPHDFARKFSDNELLGKMKIRVHWG
SSWEVKISKNPRFYFMEKSGWEKFVTDNALGRNEFLTFTHKGKMHFSVNIMKQIGKEMLQ
PPQTRAFFASSSRFKTEQGVKTEEEVVSSDLNSRGPRTAPESNGEGMCRRKLNFEKKKAE
ESQNSKRTERVVGIQRDFAGTSSSSVAGFSIVITKSYLTSLALPVSVVNFMPRVKSVVKI
HHPNGKKLWKVVFLVTRRGRLFSGGWRSLCMDYPVALGDTCKFTLINPHELLLVVTKP
Download sequence
Identical sequences R0FG33
Carubv10001579m|PACid:20908342 XP_006288334.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]