SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0GGP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0GGP4
Domain Number 1 Region: 53-486
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.51e-131
Family Pyridoxal-dependent decarboxylase 0.00000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) R0GGP4
Sequence length 537
Comment (tr|R0GGP4|R0GGP4_9BRAS) Glutamate decarboxylase {ECO:0000256|RuleBase:RU361171} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10020115mg OC=Capsella.
Sequence
MQICRVNLINTINVASSLHHLFVSFLVHLFLFHTLTRKQNTKMVLSRTQTNSDESVCTMF
GSRYVRTTLPKYEIGEASIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMD
SINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEETETAVGVGTVGSSEAIMLAGLAFK
RKWQNRRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPDKAAEM
VDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPIPVDAASGGFIAPFIYPE
LEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRAPEDLPEELIFHINYLGADQPTFTLNF
SKGSSQIIAQYYQLIRLGFEGYKNVMENCIENMVVLKEGIEKTERFNIVSKDQGVPVVAF
SLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVVIREDFSRTLAERLVSDIS
KVLHELDTLPSKISKKMGIEGIAENVKEKKMEREILMEVIVGWRKFVKERKKMNGVC
Download sequence
Identical sequences R0GGP4
XP_006302114.1.15642 Carubv10020115m|PACid:20906815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]