SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0HBF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0HBF0
Domain Number 1 Region: 110-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.07e-38
Family B3 DNA binding domain 0.0029
Further Details:      
 
Domain Number 2 Region: 492-571
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000438
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) R0HBF0
Sequence length 606
Comment (tr|R0HBF0|R0HBF0_9BRAS) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10022841mg OC=Capsella.
Sequence
MANVVDADFGRSGSNDGQLYTELWKACAGPLVEVPRSGERVFYFPQGHMEQLVASSNQGV
VDQEIPVFNLPPKILCRVLSVMLKAEHETDEVYAQITLHPEEDQSEPTSLDPPLVEPAKP
KVDSFVKILTASDTSTHGGFSVLRKHATECLPLLDMTQATPTQELVARDLHGYEWRFKHI
FRGQPRRHLLTTGWSTFVTSKKLVAGDAFVFLRGETGDLRVGVRHLARQQSTMPASVISS
QSMRLGVLATASHAVNTKSIFIVLYKPRISQFIISVNKFMVAMKNGFSFGMRFRMRFEGE
ESPERIFTGTIIGSGDLSSQWPASKWRSLQIQWDESSSIQRPNKVSPWEIEPLSPSALTP
TPTHPQSKSKRSRPIDSSVSEITGSPVASNFLSSFSQSNESNPSGKLLFHDPATERNVDK
TVLSSGLQGKNSEAPGTSCCRLFGFDLTSKPASAPVPPDRQLISVNSNNSDSTTKCQDPN
SSNSTREQKQQTSTRSRTKVQMQGTAVGRAVDLTLLRSYDELIKELEKMFEIEGELNPKD
KWAVVFTDDEDDIMLVGDDPWDEFCKMAKKLFIYSSDEVKKMSSKSLLDDEATIVNLESE
QRTVQD
Download sequence
Identical sequences R0HBF0
XP_006293856.1.15642 Carubv10022841m|PACid:20903373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]