SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for R0HFU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R0HFU5
Domain Number 1 Region: 144-390
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000385
Family Cystathionine synthase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) R0HFU5
Sequence length 890
Comment (tr|R0HFU5|R0HFU5_9BRAS) Uncharacterized protein {ECO:0000313|EMBL:EOA28509.1} KW=Complete proteome; Reference proteome OX=81985 OS=Capsella rubella. GN=CARUB_v10024724mg OC=Capsella.
Sequence
MHFPLWKQIHHCAALILDKSKSRRRGDGSDSPIDVKRKASMLRKLYEDKLRDALEEASEN
GSLFKSQQVENENQDESLGRSRSLARLHAQREFLRATALAAERTFESDDAIPQLLEAFNK
FLTMYPKYETSEKVDQLRSDEYAHLLDSKVCLDYCGFGLFSYVQTLHYWDSCTFSLSEIT
ANLSNHALYGGAESGTVEHDLKTRIMDYLNIPESEYGLVFTVSRGSAFRLLAESYPFHTN
KRLLTMFDHESQSVNWMAQTAREKGAKAYNAWFKWPTLKLCSTDLKKRLSHKKRKKKDSA
VGLFVFPAQSRVTGSKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPEFIITS
FYKVFGHDPTGFGCLLIKKSVMGNLQSQSGKTGSGIVKITPQYPLYLSDSIDGLDGLVGL
EDQDVGTNGDKPATTEAARRGAQMPVFSGAYTSAQVRDVFETELLDDNTSDRDGTSSTIF
EENESVSVGELMKSPAFSEDESSDNSFWIDLGQSPLGSDRGGHLNHHKIASPLPPFWFTS
KRQSPKPVAKNYSSPMYDGKDVLSFDAAVMSVTQETNSTPSRNLRNSNNFQIQEIQEENR
AGSGFGSNGSSSKISSDMKDNAIRRETEGEFRLLGRRGTGGRLLGVEDEQPSRGTRVSFN
MDRISHSLDQGEASLASVYDESDGENQNEDDWDRREPEIVCSHIDHVNMLGLNKTTTRLR
FLINWLVISLLQLKVPEPGSDGSSRYMNLVQIYGPKIKYERGAAVAFNVKDKSKGFVSPE
VVLKLAEREGVSLGIGILSHIRIMDLPRNHRGGARIKEDSSLHLQREAGKRGGKNGFVRF
EVVTASLSFLSNFEDVYKLWAFVAKFLNPGFSREGSLPTVIEEEAEDSET
Download sequence
Identical sequences R0HFU5
Carubv10024724m|PACid:20903303 XP_006295611.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]